Protein Info for RPSI07_RS13765 in Ralstonia solanacearum PSI07

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 72 to 353 (282 residues), 148.4 bits, see alignment E=1.2e-47

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rsl:RPSI07_1251)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>RPSI07_RS13765 ABC transporter permease (Ralstonia solanacearum PSI07)
MAEVMHGSRLALPISLELRALPSRTMAYASPLIALALTLVFGLLLFALLGKDPVAGMRVL
LIEPLATKRAIGEVLLKTVPLVLCALGLSVCYRANVWNIGAEGQLIVGGIFAAATIIYFD
TPTPAIPGGAALLLAIVAGLAGGMLWAGITALLRDRFHANEILVSLMLTYIAQLLLLYMV
NGPLKDPNGMNFPQSMVFDSAFVLPTLVAGTRLHAGFLFMLVMTAAVTLFVFRSFAGYRL
QVGGLAPQAARYAGFSSRSALWTALLVSGGLAGIAGAFEVTGPIGQLLPSISPGYGFAAI
VVAFVGRLHPVGTVLGAIVMSLFYIGGELAQSRLGLPAAITGVFQGMLLFFLLACDTLIE
YRLRWRAHR