Protein Info for RPSI07_RS10400 in Ralstonia solanacearum PSI07

Annotation: imidazoleglycerol-phosphate dehydratase HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 32 to 175 (144 residues), 215 bits, E=2.3e-68

Best Hits

Swiss-Prot: 98% identical to HIS7_RALSO: Imidazoleglycerol-phosphate dehydratase (hisB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 96% identity to rpf:Rpic12D_2880)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Protein Sequence (196 amino acids)

>RPSI07_RS10400 imidazoleglycerol-phosphate dehydratase HisB (Ralstonia solanacearum PSI07)
MSRRAEVTRNTSETQIRVALDLDGTGKQTLNTGVPFLDHMLDQIVRHGMVDLDITATGDT
HIDDHHTVEDVGITLGQAVAKAIGDKKGIVRYGHSYVPLDEALSRVVIDFSGRPGLEFHV
PFTRARVGSFDLDLSIEFFRGFVNHAGVTLHIDNLRGVNAHHQIETVFKAFGRALRMAVE
IDPRAAGTIPSTKGAL