Protein Info for RPSI07_RS06760 in Ralstonia solanacearum PSI07
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to TAUB_BURTA: Taurine import ATP-binding protein TauB (tauB) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to rsl:RPSI07_mp1522)Predicted SEED Role
"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (261 amino acids)
>RPSI07_RS06760 ABC transporter ATP-binding protein (Ralstonia solanacearum PSI07) MQATPPPLLDVRGVTLQYKTRQHRVTATYRVDFQVYPGERTILLGPSGCGKSTLLKAIGG YLAPTEGEIRLKGQPVTKPGPDRMMVFQEFDQLLPWKTVKENVLFPLLSTGKLGAREAEE RALHTIHKVNLTKFADHHPHMLSGGMKQRVAIARGMAMEPDVLLMDEPFAALDALTRRKM QDELLQLWDETRFTVLFVTHSIPEAIRCGSRILILSPHPGQVRAELPSLARGDDDPERFK ALEAEIHDMLFARAVEATHAD