Protein Info for RPSI07_RS03695 in Ralstonia solanacearum PSI07

Annotation: EscT/YscT/HrcT family type III secretion system export apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 81 to 81 (1 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 17 to 254 (238 residues), 213.8 bits, see alignment E=1.5e-67 PF01311: Bac_export_1" amino acids 23 to 255 (233 residues), 173.6 bits, see alignment E=2.6e-55

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to rsl:RPSI07_mp0819)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>RPSI07_RS03695 EscT/YscT/HrcT family type III secretion system export apparatus protein (Ralstonia solanacearum PSI07)
MESIDTVVHTWFDAGESLETLLVLLALSCVRIMTLFAILPATNDQMLTGVARNGVVYALA
ILVAAGQPVGLAAHLGAAQLFMLTCKEIFLGACLGFAASTVFWVAETAGTIIDNVSGFNN
VQMTNPLRGDQNTPIGNTLVNLAVTLFYAAGGMLFLLGVVFESFQWWPLGAALPDMNVVA
QSFLLQQTDSIFSMAVKLAAPVMMTVLLIDAGIGLLARAADKLEPTSLGQPIKGAVALLM
VMALVTALSTQVKGTLTYSQLKEQVKQGLVGDGTSPKAKTSQ