Protein Info for RPSI07_RS03670 in Ralstonia solanacearum PSI07

Annotation: EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 218 to 239 (22 residues), see Phobius details TIGR02544: type III secretion apparatus lipoprotein, YscJ/HrcJ family" amino acids 15 to 199 (185 residues), 227 bits, see alignment E=8.3e-72 PF01514: YscJ_FliF" amino acids 29 to 194 (166 residues), 91.6 bits, see alignment E=2.9e-30

Best Hits

Swiss-Prot: 62% identical to HRB3_XANEU: Protein hrpB3 (hrpB3) from Xanthomonas euvesicatoria

KEGG orthology group: K03222, type III secretion protein SctJ (inferred from 100% identity to rsl:RPSI07_mp0814)

Predicted SEED Role

"Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>RPSI07_RS03670 EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein (Ralstonia solanacearum PSI07)
MMKPRSLRLRRGALVVALALTTLLAGCNKQLFAQLTEADANDMLTVLLQAGVDAQKTSPD
DGKTWSVLVDDDAFARSMEVLHAHGLPREKYANLGDIFKKDGLISTPTEERVRFIYGVSQ
QLSQTLSRIDGVAVASVQIVLPNNDPLASVVKPSSASVFIKYRPTANVTSLLPSIKNLVV
HSVEGLTYENVAVTLVPGAADDPAIAAATARRGPAGVSWVMLGSLVGVLIGLVALWGAVT
RMPAVRTRLDALRERVASRLPARLKKREA