Protein Info for RPSI07_RS02930 in Ralstonia solanacearum PSI07

Annotation: type VI secretion system tube protein Hcp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF05638: T6SS_HCP" amino acids 5 to 139 (135 residues), 131.6 bits, see alignment E=1.1e-42 TIGR03344: type VI secretion system effector, Hcp1 family" amino acids 15 to 146 (132 residues), 82.9 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K11903, type VI secretion system secreted protein Hcp (inferred from 100% identity to rsl:RPSI07_mp0658)

Predicted SEED Role

"Uncharacterized protein ImpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>RPSI07_RS02930 type VI secretion system tube protein Hcp (Ralstonia solanacearum PSI07)
MKDIYVKFDSPAIKGESQDKDHKDWIEVNSWSQSIVQPRSATASTAGGHTAERCEHRDMV
FAKDLDVVSPLLYQHVSGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVVA
QGIPTDTFSLRYASVQWKYTQQKSAGGQGGNSQGAWSLTKNDKTYSV