Protein Info for RPSI07_RS01760 in Ralstonia solanacearum PSI07

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF03729: DUF308" amino acids 14 to 85 (72 residues), 47.9 bits, see alignment E=6.6e-17 amino acids 72 to 141 (70 residues), 45.5 bits, see alignment E=3.8e-16 amino acids 129 to 180 (52 residues), 25.6 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0397)

Predicted SEED Role

"FIG00973976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>RPSI07_RS01760 membrane protein (Ralstonia solanacearum PSI07)
MLHVLSKLWWVLALRGVCAIAIGIGAFVVPAATLAALILVFGAYALVEGLLLLVTALGNH
RAAPDRWPLLLQGLLGVAVGTLTLFSPAVTALALLFYIAAWLLAHGVLQIVVAVRLREEL
TGEWWLIAAGAISVLLAIWLLWQPQAGVLAVLWWIGAWALVWGVALVGAALRIRRWARSG
SARAFT