Protein Info for RPSI07_RS01600 in Ralstonia solanacearum PSI07

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 285 to 304 (20 residues), see Phobius details PF22588: dCache_1_like" amino acids 185 to 269 (85 residues), 54.9 bits, see alignment E=8.1e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 322 to 486 (165 residues), 168.5 bits, see alignment E=5.2e-54 PF00990: GGDEF" amino acids 324 to 485 (162 residues), 160.8 bits, see alignment E=2.4e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to rsl:RPSI07_mp0359)

Predicted SEED Role

"FIG00977816: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>RPSI07_RS01600 GGDEF domain-containing protein (Ralstonia solanacearum PSI07)
MSIFSINTPKRLIGAALLFSLTVSAGAALSLYEMRLDALKCAKDAGANIALIIERDVARN
LELYSLSVEAVLERLADPEVHQVSNHIRRLVLFDGIAQARDLGSILVTDTRGQVILDSKA
EPARNVYIGDRDYFRQQARIDSTAVLISKPLEARTGFGASITVSRRLNDAHGKFAGVIAG
ALRVNYFDRLFSGMTLGPKGSIALFYADGTLIARRPAPSATGVATKRDADAPKPVIDTTD
GLYLGKSVRDGIERLYTYRRIGHYPLYVAVGAATEDIYANWTSRAWAIGLLVAVFNLVTM
ALAYEFAKQLEKRLAAGRRHAELAITDALTSLPNRRALDACLDKEWKRALRERWPVSLLM
IDVDAFKLYNDHYGHLGGDTALKAVARCIQAHACRPGDLAARYGGEEFCVVLPHTDLEGA
AAVAEHIRQAVLALHIPHAQGPAGILSVSIGVASDTPALSGDRAETLTQAADTQLYRAKT
QGRNRTMPALPEAENGPEETPGSQATLARRSG