Protein Info for QEN71_RS43155 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details PF02790: COX2_TM" amino acids 11 to 80 (70 residues), 23.2 bits, see alignment E=1.6e-08 TIGR02866: cytochrome c oxidase, subunit II" amino acids 22 to 206 (185 residues), 171.7 bits, see alignment E=7.1e-55 PF13473: Cupredoxin_1" amino acids 110 to 182 (73 residues), 30.3 bits, see alignment E=9.1e-11 PF00116: COX2" amino acids 124 to 191 (68 residues), 67.5 bits, see alignment E=2.5e-22 PF00034: Cytochrom_C" amino acids 216 to 307 (92 residues), 30.1 bits, see alignment E=2.5e-10 PF13442: Cytochrome_CBB3" amino acids 216 to 304 (89 residues), 29 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 59% identity to reu:Reut_B4435)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>QEN71_RS43155 cytochrome c oxidase subunit II (Paraburkholderia sabiae LMG 24235)
MNPSFHLLPHSATTASGRYDALFITQTIVLLTVALAIAILIVVFSVRYRAGSKADRSNAP
TSARAVEIAWTVTPLVLFIATFIWAAYDFTQLYRVPPDAMPVFVVAKQWMWKLEHANGKR
EIDELHVPVNRPVRLVMTSQDVIHSFYVPAFRIKQDVVPGRYTTIWFIATETGEFHLHCA
EYCGTDHAAMGGRIIVMQPGEYTAWLARGNTQPGMAARGFELYRRYGCSGCHEAQASVHA
PDLHGLLGRDVHLSDGRSLIADEAYIRDSILLPRKDVVAGYKPIMPSFAGQISEEDLLAI
IEYIRSTGGDHARASQ