Protein Info for QEN71_RS42585 in Paraburkholderia sabiae LMG 24235

Annotation: hydrogenase expression/formation protein HypE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR02124: hydrogenase expression/formation protein HypE" amino acids 11 to 341 (331 residues), 416.6 bits, see alignment E=3.3e-129 PF00586: AIRS" amino acids 42 to 153 (112 residues), 82.5 bits, see alignment E=2.9e-27 PF02769: AIRS_C" amino acids 165 to 317 (153 residues), 71.4 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 43% identical to HYPE_RHOCA: Carbamoyl dehydratase HypE (hypE) from Rhodobacter capsulatus

KEGG orthology group: K04655, hydrogenase expression/formation protein HypE (inferred from 99% identity to bph:Bphy_7271)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypE" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>QEN71_RS42585 hydrogenase expression/formation protein HypE (Paraburkholderia sabiae LMG 24235)
MNINDLSRSAIVLDHGTGAKLSRELVEMIVSVLGDTYIGEMEDSALLDVDGGYLAMTTDS
FVVDPPLFGNGDIGKIAVCGTVNDLAVMGATPKFLSLALILETGLPLSTLVRVLESIRDT
AREANVKIVAGDTKVVGKGEADRIFINTTGVGFFGRAPLRMKRVRPGDRVILSGWIGNHT
IHLLSIREGLGFETRVLSDCAPLNGMLAMLFDAMPESALRSVRDVTRGGLSAVMHEYASA
LDSTIEIREPDLPIQAETAMAADMLGVDPINMANEGCLCLFVAPEHVEQVLTVLRGHPYG
RQAVEIGEVRNAGDRAVVMRTRNGELRTIEELAGAELPRLC