Protein Info for QEN71_RS42090 in Paraburkholderia sabiae LMG 24235

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 17 to 195 (179 residues), 225.8 bits, E=1.7e-71
• PF01583: APS_kinase
  • amino acids 30 to 180 (151 residues), 214.9 bits, E=2.9e-68

Best Hits

Swiss-Prot: 51% identical to CYSC_VIBPA: Adenylyl-sulfate kinase (cysC) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 96% identity to bph:Bphy_7714)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (199 amino acids)

>QEN71_RS42090 adenylyl-sulfate kinase (Paraburkholderia sabiae LMG 24235)
MTNETSTSHLYAHDFRIDPESRRRLLRQTPAILWFTGLSGSGKSAIADRVEARLHASGRL
TYTLDGDAVRLGLCKDLGFSDEDRHENVRRVSEVAKLMADAGIVVLVCLISPFRSDRELA
KSNAGKHNFAEVHVHASLAVAEARDPKGLYRLARRGAIQHFTGVDSPYEQPTAPDVFIDT
CLLSINEGVEIVLNWLDRR