Protein Info for QEN71_RS41395 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 373 to 396 (24 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 391 (365 residues), 164.9 bits, see alignment E=1.3e-52

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_6876)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>QEN71_RS41395 MFS transporter (Paraburkholderia sabiae LMG 24235)
MQAKPATQAIDERALVSKIAWRIIPFVFILYIISYLDRANIGYAALQMNRDLALSSEAFG
FASGIFFIGYFLFEVPSNVMLNKYGARVWIARILVTWGIVSVISAFAQNATQLYVLRFLL
GVAEAGFFPGIIVYLTYWFRAKELATTVALFTAAIPVSYIIGAPLSTWIMDSVHWLDWSG
WRWMLVLEGAPALIGGILCFVYLTDKPADAKWLRPEEREWLLNELANDRKAHPNAKHLGA
LKVMANPKVLYLSFIYFVYQCGSLGVGYWMPQIIKGFSKSLSHTQVGLIAMIPYVFATIV
MVAWSRSSDRHGERRLHSAIPLAVAALALLGAGLATNPYVSITMISLSLAGLYAFKSPFW
ALPTLFLTRSTAAVSIAVINSVGNLGGFVGPFAIGYIKGTGQSATPGLLFLAALLVASFL
MTFFIRINEQRVTDAHGAVANQSH