Protein Info for QEN71_RS41360 in Paraburkholderia sabiae LMG 24235

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 52.5 bits, see alignment E=4.3e-18 PF13404: HTH_AsnC-type" amino acids 4 to 44 (41 residues), 47.9 bits, see alignment E=1.3e-16 PF01037: AsnC_trans_reg" amino acids 72 to 144 (73 residues), 61 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 40% identical to Y4TD_SINFN: Uncharacterized HTH-type transcriptional regulator y4tD (NGR_a01550) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 88% identity to bug:BC1001_2059)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>QEN71_RS41360 Lrp/AsnC family transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MNSLDDFDRKLLMEVQRDAQLPQNELGARVNLSTAAVNRRLRRLADEGVIQNYTAVVAPE
KVGYLLTIIASVEVESEQIDLLDAMKRTFAQCPQIQQCYYVAGEWDFVLVLTVRNMDEYT
ALTRQLFFSNNNVKRFKTLVSMSRVKVGLSVPVDIDGK