Protein Info for QEN71_RS41315 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 225 (203 residues), 69.4 bits, see alignment E=3e-23 amino acids 225 to 426 (202 residues), 41.6 bits, see alignment E=7.8e-15 PF07690: MFS_1" amino acids 31 to 390 (360 residues), 101.5 bits, see alignment E=4.8e-33

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 77% identity to bur:Bcep18194_B2353)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>QEN71_RS41315 MFS transporter (Paraburkholderia sabiae LMG 24235)
MEKTLLAEGRDITGTADQGRRAIIATVLGNGLEWFDWTVFSFFSVTIAKLFFPTGNELTS
ILLAVGTFGVGFFMRPVGGIILGVYADKAGRKAALSLIILLMALGTAIIGFAPTYEQAGI
VAPVLIVFARLLQGFSAGGEMGGATAFLTECAPPGKRAFYSSWILSSTGFSVLLGAGVGT
FVNTSLDPAALHSWGWRVPFLLGILIGPVGYYIRSRMDETAAFSAVEEEAKHNSPLKEVL
ARFPRETLATFSMVILWTVITYVLLFYMPTYSVRTLHLDPSTGFIAGMVGGAVIMFVSPI
VGRLADVYGRRIFISGSAVAILVLVWPMFAWINRSPGLTSLLVFQIVFGALFSGYAGSIL
AAFSELFPTKVLSTGLSVAYNLAVTVFGGFTPFVVTWLMASTGSNMVPAYYVIAAAAISL
VGSRFVKDARR