Protein Info for QEN71_RS40925 in Paraburkholderia sabiae LMG 24235

Annotation: TrbG/VirB9 family P-type conjugative transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03524: CagX
  • amino acids 28 to 259 (232 residues), 188.9 bits, E=5.1e-60

Best Hits

KEGG orthology group: K03204, type IV secretion system protein VirB9 (inferred from 88% identity to bph:Bphy_7529)

Predicted SEED Role

"Forms the bulk of type IV secretion complex that spans outer membrane and periplasm (VirB9)" in subsystem Type 4 secretion and conjugative transfer

Protein Sequence (293 amino acids)

>QEN71_RS40925 TrbG/VirB9 family P-type conjugative transfer protein (Paraburkholderia sabiae LMG 24235)
MVAITACAVAAGRVCALEIPRSCGADPHIQCATYSPDQAYRVATMPGRVVMIQFESGEHI
LKDGGGIGDAHAWHVSVNDSGALLKPGALQPETNLVLVTNRRTYSLSLVDVSRLQPATWI
LRFDYPDTKAKAATEQLRRREAVSAALADQQGMPAVPAGIAAPGSAASSGPPGSSTPAAN
MQYMMRGDRALAPTALWDDGRFTYFRYATARDLPTIFTKLPDGSEATANFHMEGDTVVVH
EVSREFVIRYGQSVLGIRNDGYSPDGHYNRTASSLTGTARIERAHAGSDRPGD