Protein Info for QEN71_RS40210 in Paraburkholderia sabiae LMG 24235

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 7 to 74 (68 residues), 63.8 bits, E=4.8e-21
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 121 to 572 (452 residues), 481.4 bits, E=1.3e-148
• PF01134: GIDA
  • amino acids 122 to 188 (67 residues), 29.1 bits, E=2.5e-10
• PF07992: Pyr_redox_2
  • amino acids 122 to 442 (321 residues), 206.3 bits, E=3.2e-64
• PF12831: FAD_oxidored
  • amino acids 122 to 159 (38 residues), 32.8 bits, 2.3e-11
• PF00070: Pyr_redox
  • amino acids 290 to 365 (76 residues), 53.4 bits, E=1.4e-17
• PF02852: Pyr_redox_dim
  • amino acids 461 to 569 (109 residues), 116 bits, E=4.6e-37

Best Hits

Swiss-Prot: 62% identical to DLDH_HAEIN: Dihydrolipoyl dehydrogenase (lpdA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 89% identity to bgf:BC1003_1155)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (589 amino acids)

>QEN71_RS40210 dihydrolipoyl dehydrogenase (Paraburkholderia sabiae LMG 24235)
MTLIKAKVPDIGDFRDIEVIEVNIKAGDVIEKEQTLLSLESDKATMEVPSDVAGTVKEVK
IKAGDKASQGTVIALVEASGGATAGAAAPAPKAEAPKAEAPKAAAPAPQAGSCSGSADVE
CDMLVLGAGPGGYSAAFRSADLGMKTVLVERYSTLGGVCLNVGCIPSKALLHTALVIDEA
EALGSHGITFGKPQIDLDKLRDFKSGVVKKLTGGLAGMAKARKVEVVTGVGTFLDPNHME
VAGENGKKIVRFKQAIIASGSQAVKLPFMPEDPRVVDSTGALELRQIPQKMLVIGGGIIG
LEMATVYATLGAQIDVVEMLDGLMAGADRDLVKVWEKYNAKRFANVMLKTKTTKADAKDD
GIYVSFEGEKAPAEPQRYDLVLVAVGRSPNGKTIGADKAGVVVTDRGFIEVDKQMRTNVP
HIFAIADVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTEDQ
CKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVC
LAVEMGADATDIGKTIHPHPTLGESIGMAAELYEGVCTDLPTTRVKTSL