Protein Info for QEN71_RS39690 in Paraburkholderia sabiae LMG 24235

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 PF07676: PD40" amino acids 38 to 74 (37 residues), 32 bits, see alignment 1.4e-11 amino acids 150 to 168 (19 residues), 18.2 bits, see alignment (E = 2.9e-07) amino acids 204 to 224 (21 residues), 21.2 bits, see alignment (E = 3.4e-08) amino acids 404 to 417 (14 residues), 12.6 bits, see alignment (E = 1.7e-05) amino acids 449 to 470 (22 residues), 19.2 bits, see alignment (E = 1.5e-07) amino acids 494 to 522 (29 residues), 22.9 bits, see alignment (E = 1e-08)

Best Hits

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>QEN71_RS39690 hypothetical protein (Paraburkholderia sabiae LMG 24235)
MIPAAAAAAQNGDLLLNRIGPVTSELYVANADGTGEHRLIASDGFDYHASFSKDGQWVVF
TSERDGLGESNLYRVKIDGSGLQRLTDHIAVDDAAVISPTDPNVIAFVSSRKGDAGFGTT
NVWTLNIATGALKNVTGAIPFDASKPHSYFRPSWSPDGKWLALSSDIGSDWRGHNLPVGW
ERTQESSIYLIRPDGSGWKKIASNAGFDEGSPSWSPDGKHVVFYETPVESTWGVHRPEGI
NSVSSQLVSVDVASLARSALTSTPGFKVFPQYLNATNIAYHVKGGDTEGIYTTAGTFRST
ANTGIRSPRYSADGSKMIYEKVTFRPARANGAPLYSFDRAWNYRYIDVFPQLSADRKKLV
YTEKAINSSIAIINPDFSGYTRIYDPSTSGLDPDMVKKGLAGAFQPTWSPDRQWVAFGVG
DWFFTRGAGPGRIARIKSDGSMDGHPEFLTDGSINAGFPSYSPDGKKIVYRVWSQKVQGL
RILDLDTHTTTVLTTETDNLPGWSPDGTKIVFTRKQINPGDPNKFNYDVFTIKPDGTGLS
RLTDDGSNQGHAVWTWDGRIAYSSGTYGFRDELALYDNSFQPDGQNWVMNADGTDQHAIT
DTLWEEAMPMYIPNP