Protein Info for QEN71_RS39505 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 178 to 206 (29 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 50 to 306 (257 residues), 53.6 bits, see alignment E=2.8e-18 PF00005: ABC_tran" amino acids 381 to 532 (152 residues), 97.6 bits, see alignment E=1e-31

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_4748)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>QEN71_RS39505 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MVTPVPQTAPAARSIRTRGRRANALAAYAGSPVRLLFRYVGQHPVEHAMVTLAIVAAVGC
TLGSQFAIRNLIDALPGGRAHPAQVVNAFLVIVGLLFADNLFWRVAGWASVRTFVAVTGD
VRRELFGYLTGHSSGYFSNVQPGTLASRISATANAVFTIENLTAWNALPPLLSVIGSVVL
IGWVSVWMALALVGISVCMTCFLFWLARKGGSRHMNFASRAASVDGELVDVIGNMPTVRA
FVATARECLRFGGILEQEMTSRTASLRHLEKLRLLHAVATVLLSCVLLGWVLWLWTEGRA
TTGDVVLVGSLGFAILHGTRDLAVALVDMVQHVARLADAAQSLLVPREMEEKVGVPPLQI
RDANIDFENVTFSYAGRRRVLDHFSLHIDAGQRVGLVGPSGAGKSTVLALLQRAFDPPSG
SGAVCISGQRLCDVSLGSLRDAVAVVPQDISLFNRSLLDNLRYGRPDATEAEVLQACEHA
NCADLIRSLPDGLQTVVGERGARLSGGQRQRIAIARAFLKNAPILLLDEATSALDTESEV
KIQKALDRLMKGRTVVAIAHRLSTLQNFDRIVVIQHGRLVDDGAPNALADRPGIYRDVLL
RRERRMQA