Protein Info for QEN71_RS39490 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF00512: HisKA" amino acids 116 to 183 (68 residues), 59.2 bits, see alignment E=8.3e-20 PF02518: HATPase_c" amino acids 230 to 340 (111 residues), 95.1 bits, see alignment E=9.4e-31 PF14501: HATPase_c_5" amino acids 234 to 324 (91 residues), 23.2 bits, see alignment E=1.4e-08 PF13589: HATPase_c_3" amino acids 237 to 308 (72 residues), 27.3 bits, see alignment E=8.1e-10 PF00072: Response_reg" amino acids 364 to 475 (112 residues), 79.4 bits, see alignment E=5.5e-26

Best Hits

KEGG orthology group: None (inferred from 45% identity to aex:Astex_0692)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>QEN71_RS39490 ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MVESLNQGAACALIADEALDSRALQWVAEWLSVQPPWSDFPFILLGGNGRKGTLPTEGRR
MEVLGNVILIERPMSGEALVSAARGALRARRRQYQARAMIAERAAANARLLSAARQKDEF
LAMLAHELRNPLAPIRNAAEAIRMADETLPPRVRWAREMIERQSRHLAGLLEDLLDVSRI
TTGKVTLKCVPIELGSILTAAVDAATPSIEARHHSLNMMLPQEVVYLNADPTRMAQVFGN
LLDNAAKYTSDGGAIEINATADSEQVVVSVKDNGTGISPEELPEIFELFSQSNRALDRAQ
GGLGIGLSVVRSLVDMHGGSVEAQSGGLGLGTQMIVTLPVVQAPSAVTDPPVHAPPIAQR
GLHVLVVDDNIDAAESLAALLEMTGHHVRTAVDGLGALKECQSEAPDVVLLDIGLPGMDG
YETARRLKAMPSLSDAILIATTGYGQADDVARSKEAGFDYHFVKPVEPDTLIALLDGLRN
AGSSMHDSSLPDMTPRVT