Protein Info for QEN71_RS38755 in Paraburkholderia sabiae LMG 24235

Annotation: aldolase/citrate lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to KDSGA_PSEPU: 2-dehydro-3,6-dideoxy-6-sulfogluconate aldolase (PpSQ1_00455) from Pseudomonas putida

KEGG orthology group: K01630, 2-dehydro-3-deoxyglucarate aldolase [EC: 4.1.2.20] (inferred from 54% identity to mpt:Mpe_A0189)

MetaCyc: 39% identical to alpha-dehydro-beta-deoxy-D-glucarate aldolase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxyglucarate aldolase. [EC: 4.1.2.20]

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
D-glucarate degradation I (4/4 steps found)
D-galactarate degradation I (4/4 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

Ascorbate and aldarate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.20, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.20 or 4.1.2.n4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>QEN71_RS38755 aldolase/citrate lyase family protein (Paraburkholderia sabiae LMG 24235)
MANRIKQDPTRNAFRDALKHKDNSTMRAKPLGTWLMSGSAASAEAFGHAGFDWLLIDMEH
APLEFTDVLRMLQAVECGGAAPIVRLARNDATLAKRALDMGAPTLMFPYVQSPEEARAAV
ASIKFPPLGTRGFAAMHRASRYGTWSEFGKRANEATACIVQLETPEAVAQLEAIAAVPGV
DALFVGPGDLSAAMGKIGNLADAEVRAVLADCARRANAVGMPIGIVGPTPAMVREFAEMG
YDYVAIASDMGMMMRQANAFIAEMDQVQANANAGGPY