Protein Info for QEN71_RS38155 in Paraburkholderia sabiae LMG 24235

Annotation: YaiI/YqxD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02639: DUF188" amino acids 17 to 146 (130 residues), 162.2 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 86% identical to Y5138_CUPNJ: UPF0178 protein Reut_B5138 (Reut_B5138) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09768, hypothetical protein (inferred from 95% identity to bph:Bphy_5627)

Predicted SEED Role

"probable P23 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>QEN71_RS38155 YaiI/YqxD family protein (Paraburkholderia sabiae LMG 24235)
MQVLVDADACPVVVKEILFRAARRVEVCVTLVANQYLRTPPSRFIKAIQVPAGFDAADNR
IVELVENGDLVITADIPLAAAALDKGAHVLDPRGTWFSRENIQERLTMRDVMDQLRSSGI
ETGGPTPYSANDGKVFAGQLDRFLARYRAAPR