Protein Info for QEN71_RS37775 in Paraburkholderia sabiae LMG 24235

Annotation: 2-hydroxycarboxylate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 138 to 154 (17 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details PF03390: 2HCT" amino acids 46 to 455 (410 residues), 513 bits, see alignment E=2.6e-158

Best Hits

Swiss-Prot: 61% identical to CIMH_BACSU: Citrate/malate transporter (cimH) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_5667)

Predicted SEED Role

"Malate Na(+) symporter" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>QEN71_RS37775 2-hydroxycarboxylate transporter family protein (Paraburkholderia sabiae LMG 24235)
MATTSHASGHASGHPQPVSQPVPAQQADSKTRFWPEGWWKLMEYRIGIIPLPVYFILLAL
IAGFAVTGKVPGEISMAIAVLAFFGFTCAELGKRLPILRNIGAAAICATFVPSALTYYHL
LPKPILHLTTDFTKSTNFLYLFIASIIVGSILSMDRRVLIQGFVKIFVPLAVGSIAAAIV
GTAVGAAFGLGVRHTLLYIVVPIMAGGVGEGAIPLSIGYSEIMHLPQGELFAQVLPPVML
GSLTAIVLSGALDMLGKRLPHLTGNGRLQVGETDEMDPVKEEISGHIDVTHIAAAGITAI
TLYLLGLMCRNLFGLPAPVAMLFLAVLVKLARAVSPQLQEGAFVVYKFFSTAVTYPLLFA
IGVAMTPWDKLIAAFTFANIVTIVVTVATLMGTGFVVGRFLKMYPIDTAIVNACHSGQGG
TGDVAILTAANRMTLMPFAQIATRIGGAIVVTMTLILLAHFG