Protein Info for QEN71_RS37710 in Paraburkholderia sabiae LMG 24235

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF04321: RmlD_sub_bind" amino acids 14 to 162 (149 residues), 29.1 bits, see alignment E=1.9e-10 PF01370: Epimerase" amino acids 16 to 174 (159 residues), 81.9 bits, see alignment E=1.7e-26 PF01073: 3Beta_HSD" amino acids 17 to 139 (123 residues), 47.5 bits, see alignment E=4.4e-16 PF13460: NAD_binding_10" amino acids 19 to 122 (104 residues), 35.8 bits, see alignment E=2.8e-12 PF02719: Polysacc_synt_2" amino acids 53 to 124 (72 residues), 23.7 bits, see alignment E=9e-09 PF16363: GDP_Man_Dehyd" amino acids 58 to 172 (115 residues), 50.9 bits, see alignment E=6e-17 PF07993: NAD_binding_4" amino acids 64 to 188 (125 residues), 31.3 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 54% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_5673)

MetaCyc: 54% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>QEN71_RS37710 NAD(P)-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MNETSAVPRKPFRRLLLTGAGGNLGRQLRDALAAWADIVRVSDIVPVSAAAAHEEASVVD
LADREAVMHMVEGVDAIVHLGGISIDAPFDDLIESNIRGTYNLYEAARKHGVKRVVFASS
NHAIGFHPVTEVLDADAPTRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEEPK
NPRMLVTYLSYRDFIELVRCSLLTNRVGHAVVYGASDNPIKWWDNTKAGFLGFRPRDSSV
QFAERFPVTGPTPEYDDPAQRFQGGAFVLGEPMERKA