Protein Info for QEN71_RS37235 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 7 to 361 (355 residues), 105.6 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_5770)

Predicted SEED Role

"acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>QEN71_RS37235 acyltransferase (Paraburkholderia sabiae LMG 24235)
MDKGRVAALDAGRALAIVGVVAVHLSFQFPNLPHAVTLMARMGQYGVQLFFVISAITIFM
TLEIDHERCTDARHVTLRFYIKRFFRIAPLYYSAIAVYGAISFGAMHSGYERAWVLGAHG
PVDILLNVLFLHALSPTAINNVVPGGWSIGVEMLFYLIAPLLFFAAMNRVRLMLATLLLL
ALSVATLSIGDCNGTLDCQVSNNSFSYFWPPVQGPCFIVGMWAWYGFRSHLLGTSNVTKR
GAWLYFALAVTFAIATAALGVWLAKSHAFAPVFAACAAVAFLLFVCSQSDAMRRLMQSRM
TLFVRHCASALGRESYGIYLWHFICVYATFHFFEGTFRRTDRDASLALYVVTVLTALLAS
YGFSRLSDRLIQGRATRLSRKLLSHVDGRFHPSRRA