Protein Info for QEN71_RS37005 in Paraburkholderia sabiae LMG 24235

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details PF04143: Sulf_transp" amino acids 14 to 132 (119 residues), 31.7 bits, see alignment E=6.1e-12

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 83% identity to bph:Bphy_5807)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>QEN71_RS37005 YeeE/YedE family protein (Paraburkholderia sabiae LMG 24235)
MSIDMGNFTPLFSLVGGVVIGVAAAVLILFNGRIAGISGILGGILGASRDEAGWRAAFIV
GLIAAPVLASMLGKPVMPDIQAGWGELIVAGFLVGIGTRYASGCTSGHGVCGISRGSVRS
LVATATFMAAGFVTVFVLRHITGGWGG