Protein Info for QEN71_RS36900 in Paraburkholderia sabiae LMG 24235

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 16 to 236 (221 residues), 377 bits, see alignment E=1.4e-117 PF00116: COX2" amino acids 149 to 217 (69 residues), 31.4 bits, see alignment E=1.6e-11 PF06481: COX_ARM" amino acids 236 to 279 (44 residues), 59.8 bits, see alignment 1.9e-20

Best Hits

Swiss-Prot: 53% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 92% identity to bph:Bphy_5824)

MetaCyc: 56% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>QEN71_RS36900 ubiquinol oxidase subunit II (Paraburkholderia sabiae LMG 24235)
MRRHLVRAGRVVAAGALSLLGGCSMVLFDPKGDIGVQEKNLILIALGLMLLVVIPVIALT
LYFAWRYRESNTKAKYAPTWAHSTAIEVVVWTIPCIIVATLAVLIWKTTHSLDPYKPLES
DVKPVRVEVVALNWKWLFIYPDYGVASVNQLALPVDTPVDFRLTAESLMNSFFIPQLGSQ
VYAMSGMQTQLHLIANSEGTYAGRSSAFSGPGFSDMDFNTVVTSRGEFDAWVAHAKASPK
ALDVAAYDVLQQPSRKNAVTLYSNVAPGLFDGIVYQYMRDASGRPICTTANADMYVKPAR
LPSHAALVSE