Protein Info for QEN71_RS36615 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 237 (214 residues), 84.9 bits, see alignment E=5.8e-28 PF07690: MFS_1" amino acids 60 to 369 (310 residues), 85.1 bits, see alignment E=4.6e-28 amino acids 266 to 423 (158 residues), 38.9 bits, see alignment E=5e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_5847)

Predicted SEED Role

"Metabolite transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>QEN71_RS36615 MFS transporter (Paraburkholderia sabiae LMG 24235)
MVTEQPGATPLSEEDARRQLRRAVIASTIGTTIEWYDFFLYSTVTGLVFAKLYFPESDPL
VGTLQAFLIYAVGFIARPVGAAIFGHYGDRIGRKATLIVTLLLMGLATFAVAFVPTYATI
GIWGAVLLTILRFIQGVGVGGEWGGSVLMSMEWARTNAHRGFVASWPQFGVPAGLFIANL
AVLAISQISGNAFLTWGWRVPFFLSIVLVAIGLYIRLNILETPIFARLLAERKIEKAPAL
EVIRRQPKDILLSALARMAEQAPFYIFTAFVFTYGVRTLGASRDLLLTAVLAASLLEFVT
IPLFGHVSDLIGRKRMYMIGAALVGIFGFVYFAMVDTKNPVWIFAAIVLSLVPHSMLYGP
QAALIAETFTGRLRYSGASLGYQLASVIAGGPAPLIATALFAYYHSGYAIAVYIFVCAVI
SLLATSRLGDYTNRDISREYDEARRMDDHGHPTPAR