Protein Info for QEN71_RS36395 in Paraburkholderia sabiae LMG 24235

Annotation: TetR family transcriptional regulator C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00440: TetR_N" amino acids 60 to 103 (44 residues), 37.3 bits, see alignment 1.9e-13 PF13977: TetR_C_6" amino acids 128 to 233 (106 residues), 45.5 bits, see alignment E=8.2e-16

Best Hits

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>QEN71_RS36395 TetR family transcriptional regulator C-terminal domain-containing protein (Paraburkholderia sabiae LMG 24235)
MEGTAQGGMHVRDKLTNSTQGCRVQRTDKETMQTTSTTSTALKDDRKEDPGPYDGMRLRL
IESTLAVVGDVGLENLTIRRVSDHAGVSVGLVHHHFDNKKSLVYKTFEHLIRRVRDQLTT
GRRGIANPVERMKFTADLCFSDEVMSPGAANVWPHMWSSSAHDAEVQRLCAAFSKRLRSN
FIFDLRQAGCDHTMARIHAIQALALVHGLWIEHRVAASVTIDEVIGIFHGMIDDATRQIW
KLNMSRAAKSATVS