Protein Info for QEN71_RS36145 in Paraburkholderia sabiae LMG 24235

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details PF04290: DctQ" amino acids 31 to 160 (130 residues), 81.1 bits, see alignment E=3.6e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>QEN71_RS36145 TRAP transporter small permease (Paraburkholderia sabiae LMG 24235)
MRGPLDRVVHLLDVFCRGVALSAGVAVIATVAVISYGVLAREVLHLSDVWVTEVTTYLMA
YMTFVGTAALAWQSRHLKIDVLGHHLGEGGKRVLAAFSTLVMSAVAVVIAALAVQFWWDA
YTSGERSWGMFSLPLWIPYLCLVIGALLLTLVQLVRLATILFARREASHDLSIDELALGR
DK