Protein Info for QEN71_RS35820 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 375 (357 residues), 202.1 bits, see alignment E=6.3e-64 amino acids 265 to 410 (146 residues), 55.1 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: None (inferred from 64% identity to bpr:GBP346_A2225)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>QEN71_RS35820 MFS transporter (Paraburkholderia sabiae LMG 24235)
MNGKTLPAKRWWIILPIAFITYSLAYLDRANYGFAAAAGIDHDLGISRSTSSLIGSLFFL
GYFFFQVPGGIYAERRSVRRLIFVSLIAWGGLAALTGVVSNIPALMAVRFGLGIVEAAVF
PCMIVYLTNWFSRKERSRANTVFLLGNPATVLWMSVVSGYLVQEWGWRAMFIAQGLPAVL
WAFVWLAVVRDKPSQVSWLTAEEKLHIETTLADEQRSLAPVKNYREAFRSRTVWKLTGTL
FFQSLGFYGFLLWLPSILRHGASLSMVNTGWLSAIPYFGAVLCMLPCSWLSDRLQNRRLF
VAVPLSIAAAAFFLLYVVGTSNFWLSFSLLTVAGISMYVMFAPFFSIAPEVLPREVAGGA
IALINSIGALGSFLGSYAVGYLTGLTGDPASSYLFMGAALVVSALFASSVKRTERARIMP
LATAD