Protein Info for QEN71_RS35170 in Paraburkholderia sabiae LMG 24235

Annotation: macrolide transporter subunit MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 267 (229 residues), 104.4 bits, see alignment E=3e-34 PF16576: HlyD_D23" amino acids 51 to 266 (216 residues), 39.3 bits, see alignment E=9.1e-14 PF13533: Biotin_lipoyl_2" amino acids 62 to 105 (44 residues), 27.5 bits, see alignment 4.3e-10 PF13437: HlyD_3" amino acids 187 to 274 (88 residues), 38.8 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 68% identity to bpd:BURPS668_A0927)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>QEN71_RS35170 macrolide transporter subunit MacA (Paraburkholderia sabiae LMG 24235)
MKKPSRRLRYVAAGILVAALAVLLMWDWFVPDTRVQYLTAKVERGDLENAVLATGTLQAF
SQVDVGSQASGQLRALKVKLGDKVVKDQWLAEIDPVLSENALRQAHTTVDNLVSQRRATA
AQLAQADLALARQRKMIADDATAHQDLESAQAAAGVQRATFSALDAQIRAARIQVETAQA
NLGYTRIVAPMGGEVVAIVTQEGQTVIAQQQAPVILKLANLDTMTVKAQISEADVIRVHP
GQTAWFTILGAPDTRYYGRLRAIEPAPQNFLDTQTSPGGTGSASSKPGTAIFYNALFEVP
NPGHLLRISMTAQVSVLISTAHDVLSVPVAALGAKTPDGRYAVRVAGADEQVQTRLVHTG
LNNNVRVEIRDGLRAGERVVVGEAPANAADAPAGDNALTGIIGP