Protein Info for QEN71_RS34660 in Paraburkholderia sabiae LMG 24235

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 315 to 332 (18 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 101 to 234 (134 residues), 95 bits, see alignment E=2.6e-31

Best Hits

Predicted SEED Role

"C-5 sterol desaturase (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>QEN71_RS34660 sterol desaturase family protein (Paraburkholderia sabiae LMG 24235)
MFASLFSMYAVPALSGENQKLPSMSPYAIACAVGGGLIFAEAALLKILRRERTAWMELVF
NLNSGHIVMWAFRGVEIAAYAAVFRHLNLHSVDRLPRAAQWIFGLFAWDFCFYWRHRAHH
RLGLLWAVHVVHHQGERFNLSLCNRNSWYASLTDFPFSGVLAVLGLPLDVYVTVSSFHYA
IQFFNHCGLIQSAGVLDRFLVTPRHHRVHHRAEPQFFNRNFGGSFLLWDKLFGTFAQTTD
HADARYGVDGIANSRNPLRASHEPLLHCVGGSWPNGSFSPPQQMNSTFVALRGLLLYGLL
ICWLDTQQGVHSNPHWLLMVCSLTGTIALGAHCDGERWGTLGWSALAIAMPALLASDRAA
SGTVPTVLLVLFAMHGIFGMIQFARIAPSASRLPPR