Protein Info for QEN71_RS34455 in Paraburkholderia sabiae LMG 24235

Annotation: LuxR C-terminal-related transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF01590: GAF" amino acids 10 to 151 (142 residues), 24.2 bits, see alignment E=4.4e-09 PF00196: GerE" amino acids 177 to 228 (52 residues), 57.7 bits, see alignment E=7e-20

Best Hits

KEGG orthology group: None (inferred from 81% identity to bug:BC1001_0850)

Predicted SEED Role

"Putative response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>QEN71_RS34455 LuxR C-terminal-related transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MRHTTRDDPALEAAVATLARFVRPGATVFYRIGSDCQPSGFELFGLAEVMHRTYLQRYCL
LDPLHPSRYVQQCGSVLTLAGELPETLRSQSVYWQRFLRPHRVIDVMEVLLRDDGRIAGA
FSLMRFAPDAPFSQQEIESANALAPLLEVALTASLRREPALSLRERAANAPGRAARLTHR
EEQIARLVRNGLSNKAIARDLALAQPTVKTHLLRMFRKLGVSSRTELIGALFH