Protein Info for QEN71_RS34275 in Paraburkholderia sabiae LMG 24235

Annotation: dihydrodipicolinate synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00701: DHDPS" amino acids 3 to 288 (286 residues), 210 bits, see alignment E=1.6e-66

Best Hits

Swiss-Prot: 32% identical to DAPA_BARBK: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 86% identity to bmu:Bmul_5264)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52, 4.3.3.7

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>QEN71_RS34275 dihydrodipicolinate synthase family protein (Paraburkholderia sabiae LMG 24235)
MQMKGILPALVTPFNASGAVDHDTLANILEFQLKAGVTGFVPLGSTGEYYALTHDERRAI
LKTVREVVGGRGTLIGGANGSSTREVIEQTRLVRDAGYTNVLIAPPYYALPSQEELIGHY
EAILEAVPDVNVILYNYPVRTNVEVGFGVLDAFKDHPRVVGIKESSGNLLRAIEIGEKYK
GNYQLSCGSDDQALDFFLWGATSWICGPANCFVKQVVEFYNRFAADDIRGAQNVMRTLFP
VMATMEAGKFVQKVKYGCELAGFKVGAARMPLKPLTDEEKADFRAVFEAVQA