Protein Info for QEN71_RS33915 in Paraburkholderia sabiae LMG 24235

Annotation: two-component system response regulator NarL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 96.5 bits, see alignment E=2.2e-31 PF00196: GerE" amino acids 152 to 206 (55 residues), 73.2 bits, see alignment E=2.1e-24 PF08281: Sigma70_r4_2" amino acids 152 to 190 (39 residues), 28.8 bits, see alignment 1.5e-10 PF13412: HTH_24" amino acids 166 to 191 (26 residues), 23.8 bits, see alignment (E = 5.5e-09)

Best Hits

Swiss-Prot: 53% identical to NARL_ECOL6: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07684, two-component system, NarL family, nitrate/nitrite response regulator NarL (inferred from 98% identity to bph:Bphy_5911)

MetaCyc: 53% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>QEN71_RS33915 two-component system response regulator NarL (Paraburkholderia sabiae LMG 24235)
MEPVNTVLLIDDHALFRKGVAQLIQMNPEFRVVGEASSGRVGVDLAVRLKPDVVLIDLNM
PDMNGIETLEMMREHGVDARFLMLTVSDNERDVVAALRAGASGYLLKDMEPEELCLNLQK
ALQGTAVLSEAVTGKLFHALSAGQPLPANQSNLSAREQEVLDYLVEGMCNKEIARKLDIS
VGTVKVHVKHLLHKLDLHSRVEAVVWHHEHLARRNPPGA