Protein Info for QEN71_RS33755 in Paraburkholderia sabiae LMG 24235

Annotation: glutamine ABC transporter substrate-binding protein GlnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 28 to 242 (215 residues), 222.7 bits, E=4.3e-70
• PF10613: Lig_chan-Glu_bd
  • amino acids 41 to 117 (77 residues), 38.9 bits, E=8.4e-14

Best Hits

Swiss-Prot: 65% identical to GLNH_ECO57: Glutamine-binding periplasmic protein (glnH) from Escherichia coli O157:H7

KEGG orthology group: K10036, glutamine transport system substrate-binding protein (inferred from 94% identity to bph:Bphy_1156)

MetaCyc: 65% identical to L-glutamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Protein Sequence (248 amino acids)

>QEN71_RS33755 glutamine ABC transporter substrate-binding protein GlnH (Paraburkholderia sabiae LMG 24235)
MKLVAKLVAAALVAVSVLGHAARAETLLVACDTAFVPFEFKQGDKYVGFDIDLWEAIAKD
LKLDYKLQPMDFSGILPALQTHNVDVALAGITIKDERKKVIDFSDGYYDSGFLLMVPATS
AIKGPDDLKGKSLAIKTGTSAADYAKAHFAGTELRQFPNIDNAYLELQTGRVDAAMHDTP
NVLYYINTAGKGRVKAVGPQMMAQQYGIGFPKGSALVPKVNAAIAKIKADGRYAAIYKKW
FGVEPTKS