Protein Info for QEN71_RS33195 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 18 to 356 (339 residues), 72.2 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to bph:Bphy_6420)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>QEN71_RS33195 acyltransferase (Paraburkholderia sabiae LMG 24235)
MAITLNVPASSGSGKSLKIDAIRFLAAFWVLMYHFKPPLFKQLLPHQLSFLGGALWSGAT
ALFAGPAAVIVFFVISGYCIHAAYHKDVALKPVNYYASRFIRIGLPLVVLLCVVQPLPTG
QNYLESVLWSLYCEMIYYAVYPLLRPRFRYIGEMIVGCALLAVAMVACVRLFGHPVCHGC
VYETYRVPGTALLYAAGWISGCLIAETQRNTAQFQIRGAYSPLTVALKRALNASTRVLAK
HLIVLRVVVVAAGAAVMILLSDSSLKPAMLPLITPDITLPVFQILAVVWIATETATPSRS
RVWSTLAACGAWSYSLYLCHKTALALLEVTSFDESWRFAWFVEVALAFAISYAFYRVIEK
PSHVISQRLRKYAPDVPGAPAA