Protein Info for QEN71_RS33045 in Paraburkholderia sabiae LMG 24235

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00746: carbamate kinase
  • amino acids 1 to 300 (300 residues), 426.2 bits, E=3.1e-132
• PF00696: AA_kinase
  • amino acids 1 to 281 (281 residues), 86.5 bits, E=1.2e-28

Best Hits

Swiss-Prot: 81% identical to ARCC_PSEAE: Carbamate kinase (arcC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 94% identity to bph:Bphy_6441)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.2

Protein Sequence (312 amino acids)

>QEN71_RS33045 carbamate kinase (Paraburkholderia sabiae LMG 24235)
MRIVIALGGNALLQRGQPMTENQQRENVRVAAAQIARVAAGNELVIAHGNGPQVGLLALQ
SAAYTEVAPYPLDVLGAQTEGMIGYLIEQELGNLLPFEVPFATILTQVEVDLADPAFSHP
TKPIGPVYTKEEALRLAQENGWSIAEDGDKYRRVVASPRPQRIFEIRPVKWLLERGTVVI
CAGGGGIPTCYDENRKLRGVEAVIDKDLCSALLAQELDADLLVIATDVNAAYVDWGKPTQ
KAIASGHPDELEKLGFAAGSMGPKVQAAVEFARKTGKDAVIGALPDIEAITQGTAGTRVS
VRDPGVGFYSLA