Protein Info for QEN71_RS32795 in Paraburkholderia sabiae LMG 24235

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF01590: GAF" amino acids 69 to 197 (129 residues), 42.5 bits, see alignment E=3.4e-14 PF00158: Sigma54_activat" amino acids 364 to 527 (164 residues), 211 bits, see alignment E=3.3e-66 PF14532: Sigma54_activ_2" amino acids 376 to 532 (157 residues), 57.8 bits, see alignment E=5.3e-19 PF01078: Mg_chelatase" amino acids 384 to 500 (117 residues), 25.9 bits, see alignment E=2.2e-09 PF02954: HTH_8" amino acids 646 to 681 (36 residues), 41.7 bits, see alignment (E = 2.7e-14)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_6490)

Predicted SEED Role

"Transcriptional activator of acetoin/glycerol metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (701 amino acids)

>QEN71_RS32795 sigma-54-dependent Fis family transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MSSLVDINSHVRDVLNIVNNQPATCSMSHSVAQSWTRCLVDFGLDPGRFVMPPVLTQQEL
TQRREAADDLIACSKLEMTTLYQQLADPELAVILVDANGVIVHQVSSVPFGEAVAADGLR
IGAVWSEREAGTNGMGTCLTERECLAIYQHEHFYPRYTSLTCSAAPIFDERGTIVGVLDV
TSRSKMLQQHSLVLVGMSRQMIENRLIDSRYRRANTVHFHSRPEFVGTLHAGKLAVDDDG
VVLAANRSALFQLDLRSPDQLCGKRIEEAFSATLEDMIARSIRGSFHPITVYSAHANNRF
FLIAQTPRDAASFGGASQGAPSARGPWSDVSINRSPRAKNPRDAREAKPAAAGLDKLSHL
EFGDPRMAAQSQLAARVIQRKIPIILRGQTGTGKEVFANALHSISPNAAGAFVAVNCASL
PETLIESELFGYRAGAFTGAQREGRRGKIVQANNGTLFLDEIGDMPMALQARLLRVLEEH
EVTPLGAETTIKVDFQLISASHRNLLDLVQRGLFREDLYYRLNGIEINLPPLCERADLLP
LVQHILESESDDPPELSAEARQALSSYAWPGNIRQLRHVLQMAIALCDGPEIRCAHLPAE
IVDDANDTQSRASAAGQFAQPMRPPAAPPFDDDTDLSALNAIQLKERETVLAMLDEHRWN
VSNVAKTLGISRNTLYRKMHRLHIRLSHDGAQATADVEPGA