Protein Info for QEN71_RS32660 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome D1 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 83 to 119 (37 residues), 32.6 bits, see alignment 3e-12 PF02239: Cytochrom_D1" amino acids 184 to 332 (149 residues), 42.2 bits, see alignment E=1.7e-14 PF10282: Lactonase" amino acids 209 to 363 (155 residues), 42.6 bits, see alignment E=1.8e-14 PF00400: WD40" amino acids 293 to 318 (26 residues), 14.3 bits, see alignment (E = 2.1e-05)

Best Hits

KEGG orthology group: None (inferred from 90% identity to bph:Bphy_6515)

Predicted SEED Role

"surface antigen"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>QEN71_RS32660 cytochrome D1 domain-containing protein (Paraburkholderia sabiae LMG 24235)
MQRTIGYKRGHTRGHTRRSGRVAASVALAVLMGTAAGEASAAAVAYVTSETNGVGVIDLD
QMTLTKTIGLGKDGPRGLSLTADGRRLLVANKSGDLSAIDTSTDKVVARVKIGKNPEFVR
VHRGFAYVTYEPGESGPPPQAMAANQDAGKPDAKPEGKPETEAAGGKGGKGGHDDDDDAN
SPPAEVAIVDLKTMKVVRSVKSGHETEGVEFSPDGHELLVTNEGDDTVSVYRTGTGKLVR
TLKLDKGSRPRGIKASPDGKQYVVTLENTNKFVVLDAGTLKTVKTVDTKMGPYGVAFDPS
GKHLLVAAARDKTLQVFDAKTYEHVTDAPVGQRCWHFSFTPDGSKVLMACGRSNAVFVLD
AKNNYQTVSQIGDLPLAWGIVTSPPSQGSIESR