Protein Info for QEN71_RS31495 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 211 to 238 (28 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 70 (46 residues), 49 bits, see alignment 4.5e-17 PF00528: BPD_transp_1" amino acids 111 to 292 (182 residues), 120.5 bits, see alignment E=7.3e-39

Best Hits

Swiss-Prot: 48% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 96% identity to bph:Bphy_6649)

MetaCyc: 47% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>QEN71_RS31495 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MATPIDAQSASTAAVQPRRKRRGLVRFMRNKAAVFGAFLVALIVVMAVFAPWLTQYDPVQ
ASFMTVRQAPSAAHWFGTDELGRDVLSRLLYGARASLLAGVVSVGIAVVLGVPLGLLAGY
FGKLVDGVISRIADALLSIPFLILAIALSAFLGPSLTNAMAAIGISAMPRFIRLTRGQAI
SVKAEEYVEGARAIGLDHARIILRYILPNVLPPIIVQASLTVASAIIAEASLSFLGLGQL
PPAPSWGSMLNTAKDFVSQAPWMSIFPGIAIFLAVLGFNLLGDGLRDALDPRES