Protein Info for QEN71_RS31475 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00005: ABC_tran" amino acids 29 to 189 (161 residues), 99.8 bits, see alignment E=2.2e-32 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 238 to 324 (87 residues), 95.4 bits, see alignment E=8.6e-32 PF08352: oligo_HPY" amino acids 240 to 304 (65 residues), 82.6 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 53% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 96% identity to bph:Bphy_6653)

MetaCyc: 48% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>QEN71_RS31475 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MTGAERRPVLDVRGFSLKFSNSPDVPNVVDNVSFPVHAGETLCMVGESGCGKSVTSLALM
GLLASPPARRVAGTAHFEGVDLFALSERELADIRGNRMSMIFQEPMTSLNPAYTIGEQIG
ESIRRHRGVNRAQARDEALKMLRLVHIPAPETRLDAFPHQLSGGMRQRVMIAMALANSPR
LLIADEPTTALDVTIQAQVLSLVRTLQAETGTAMLLITHDLGVVAEVADHVAVMYAGRIV
EYGTVADLFDDPQHPYTIGLMGAIPSVGKREGALATIRGSVPSPEQMPRGCRFAPRCPFA
EQRCIDAAPPERTLSGEHRVACWLAPVEQLVQPAQQKVTT