Protein Info for QEN71_RS30895 in Paraburkholderia sabiae LMG 24235

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 7 to 116 (110 residues), 102.5 bits, E=1.5e-33
• PF00196: GerE
  • amino acids 155 to 208 (54 residues), 56.6 bits, E=1.5e-19

Best Hits

Swiss-Prot: 36% identical to NREC_STACT: Oxygen regulatory protein NreC (nreC) from Staphylococcus carnosus (strain TM300)

KEGG orthology group: None (inferred from 72% identity to rme:Rmet_4715)

Predicted SEED Role

"two component transcriptional regulator, LuxR family"

Protein Sequence (258 amino acids)

>QEN71_RS30895 response regulator transcription factor (Paraburkholderia sabiae LMG 24235)
MNIKHRVIIAEDHDLLRSGLRSMLSTQSEYEVVGEARDGKEACQIAMSVAPDLILMDLSM
RGMNGIDATAAIKRRSPDVRIIALTVHQSEEYVREALRAGVDGYVLKDVSFDELLFAMRT
VMQGKKHLSADVYGFMVDSFVTGREIAAPKKAWDLLTARERSVLKLIAEGRTNRQVGQYL
NLSPKTIEKYRASVMHKLEIENVTGLVLAAISMGLLTSLASKCAEPDSDDKLTCLGVDDT
HVTHDPGTLPRMTGTEAG