Protein Info for QEN71_RS30315 in Paraburkholderia sabiae LMG 24235

Annotation: fatty acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 239 to 263 (25 residues), see Phobius details PF00501: AMP-binding" amino acids 38 to 410 (373 residues), 260 bits, see alignment E=3.3e-81 PF13193: AMP-binding_C" amino acids 460 to 542 (83 residues), 59.3 bits, see alignment E=6e-20

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 93% identity to bph:Bphy_7172)

Predicted SEED Role

"Medium-chain-fatty-acid--CoA ligase (EC 6.2.1.-)" (EC 6.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>QEN71_RS30315 fatty acid--CoA ligase (Paraburkholderia sabiae LMG 24235)
MRETETPDHLITAAASAYAYPLLVKQLLVNSLSVRADQEITYRGELRYTFAAFHRRVGQL
ANALASLGVRAGSTVAVMDWDTHRYLESYFAIPMMGATIFTVNVRISAQQIAYTLNDARA
DVLIVNSEFLPVLEAIRGELKHVREVIVASDDTPMPSTSFAIAGEYEQLVSSMPEDFAFE
DFDENTRAAIFYTTGTTGDPKGVCYSHRQIVLHTLATATTLCSPRTGQRLHRDDVYMPIT
PMFHVLAWGMPYIAVMLGLKIVLPGRYQPDTLLHLKKTERVTFSHCVPTILQMLLDAAAR
DAHDLSGWTMIIGGSALSPSMCRAALEQGIDVFAGYGMSETGPVAALSQFAPDVATAGID
ESVRKRCMTGRPVPMVELRVVDAQMNDVPRDGRAQGEIVLRSPYLTPGYHNKPEASEALW
EGGYLHTQDVAVMTPDGYVQIVDRIKDVIKTGGEWVSSIEIEALINELHGVEESAVIGVQ
DERWGERPKALIVLRPHATLDAQAVRAHLLGHADAKRISRYAVPEAERVIFVAAIPKTSV
GKIDKKLLRQRFE