Protein Info for QEN71_RS30165 in Paraburkholderia sabiae LMG 24235

Annotation: DUF3300 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF11737: DUF3300" amino acids 46 to 280 (235 residues), 312.9 bits, see alignment E=6e-98

Best Hits

KEGG orthology group: None (inferred from 87% identity to bph:Bphy_7194)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>QEN71_RS30165 DUF3300 domain-containing protein (Paraburkholderia sabiae LMG 24235)
MSPCHLQRAFTLCLWIVVALTFGIGGARAQTQQPASAPAPAEPFKPEEIEALVAPIALYP
DSVLSQVLMASTYPLEIVHAARWVKANPNVKGDAAVKAVENQPWDVSVKSMVAFPQILEP
MNDKLEWTQKLGDAFLAQQKDVFAAVQRLRARAKDSGNLKSNEQQNVVVEQPPAGGGQTI
IKVEPTNPQVIYVPAYNPTVVYGAWSYPTYPPTYWPPYPAYYPGAALMTGFAWGIGLAAA
GAIFSNCNWGGGDVNINVNKAANIDRNFDRTKVEGGRWQHDGSHRQGVAYRDNATREKYS
RNVPGAEGRSDFRGRDSGAGGGRVNTADRAGAGAGAGNRAGTADRGNAGNRASATDRSNT
GNRASTADRSAAGDRGGVSNRAGAGSGDVTRASDRVGGSAGGGNFSGGRDNAFQGVGSGG
ASQRNYDRGRSSMQGSGFNRPSGGGMRAGGGGRGRR