Protein Info for QEN71_RS29785 in Paraburkholderia sabiae LMG 24235

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF01728: FtsJ" amino acids 31 to 78 (48 residues), 23.6 bits, see alignment 2.3e-08 PF01135: PCMT" amino acids 32 to 139 (108 residues), 30.3 bits, see alignment E=1.8e-10 PF13489: Methyltransf_23" amino acids 32 to 194 (163 residues), 69.5 bits, see alignment E=1.4e-22 PF05175: MTS" amino acids 32 to 140 (109 residues), 24.5 bits, see alignment E=9.7e-09 PF01209: Ubie_methyltran" amino acids 34 to 139 (106 residues), 49.2 bits, see alignment E=2.4e-16 PF07021: MetW" amino acids 38 to 132 (95 residues), 22.7 bits, see alignment E=3.6e-08 PF13847: Methyltransf_31" amino acids 39 to 149 (111 residues), 77.2 bits, see alignment E=6e-25 PF13649: Methyltransf_25" amino acids 44 to 137 (94 residues), 72.4 bits, see alignment E=2.1e-23 PF08242: Methyltransf_12" amino acids 45 to 139 (95 residues), 64 bits, see alignment E=8.7e-21 PF08241: Methyltransf_11" amino acids 45 to 139 (95 residues), 79.4 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_7237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>QEN71_RS29785 methyltransferase domain-containing protein (Paraburkholderia sabiae LMG 24235)
MSKAPSLQLDSATLADEYDRLGIRQFNHGLQLLDALALREGERVLDVGCGTGRLTESAAQ
RVGTQGDVLGLDPLPLRVERALQRAQGRFAARVGRAEELAGIADSHYDVVYLNSVIHWIP
DQPKALREAWRVLKPGGRLGFTTMPADVPHDLHRVLHTLIAKDTDSQRAEIGAPNKLTRD
SAASLLSTLGFDVTLNEIREFDDAFDNVDDVLTFSRASSFGNFLSSLAEPQIAQLRERLA
DALEAHRGPRGLQLARRLIFVTARKPLAH