Protein Info for QEN71_RS29680 in Paraburkholderia sabiae LMG 24235
Annotation: 50S ribosomal protein L34
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL34_PARXL: 50S ribosomal protein L34 (rpmH) from Paraburkholderia xenovorans (strain LB400)
KEGG orthology group: K02914, large subunit ribosomal protein L34 (inferred from 100% identity to bvi:Bcep1808_3313)MetaCyc: 64% identical to 50S ribosomal subunit protein L34 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L34p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (44 amino acids)
>QEN71_RS29680 50S ribosomal protein L34 (Paraburkholderia sabiae LMG 24235) MKRTYQPSVTRRKRTHGFRVRMKTAGGRKVINARRAKGRKRLAI