Protein Info for QEN71_RS29480 in Paraburkholderia sabiae LMG 24235

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 232 to 263 (32 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 377 (359 residues), 92 bits, see alignment E=1.9e-30

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_3065)

Predicted SEED Role

"Transporter, monovalent cation:proton antiporter-2 (CPA2) family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>QEN71_RS29480 cation:proton antiporter (Paraburkholderia sabiae LMG 24235)
MKSAFSFFPGWPLTPDAIFWAGLALLAAGLVGELCYRAWHLPRISGYAVIGLIAGAAGSG
VIDADSAATARPLLDVALGLLLFELGSRLDLRWIRRNTWLIVSSVAESTLTFVLVLLVLL
FLNVSTVTALVLASIAMATSPAMVIQLKTELRAEGQVTQRLMTLTALNSMYAVIIEKLAS
GWLHQEAYGNLLATILQPLYLLIGSLILAYLLARTITFFYKRVNLQDEHSFVALFGLVLL
AIALAHIFKLSTILSLLAAGIIVKNLEARPQLWPAHFGTAGWLLTVILFVLTLTTFEWRD
IAIGGLAALGLIVARLIAKLVGVLAFAKPSGLNMKQGVALGLSLSPMSALAYLLVDDTYQ
LYPNFDPTLRAVTMCSIVVLQLVGPWLVYRSLALVGERRE