Protein Info for QEN71_RS28660 in Paraburkholderia sabiae LMG 24235

Annotation: 5-oxoprolinase subunit PxpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 236 (234 residues), 323.8 bits, E=3.6e-101

Best Hits

Swiss-Prot: 96% identical to PXPA_PARP8: 5-oxoprolinase subunit A (pxpA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K07160, UPF0271 protein (inferred from 96% identity to bph:Bphy_2905)

MetaCyc: 61% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.9

Use Curated BLAST to search for 3.5.2.9

Protein Sequence (250 amino acids)

>QEN71_RS28660 5-oxoprolinase subunit PxpA (Paraburkholderia sabiae LMG 24235)
MEIDLNADLGEGCGSDEALLDLVSSANIACGWHAGGPNAMRECVRWAVQKGVSIGAHPSF
NDPENFGRKEMDLPAGEIYAGVLYQLGALSAIAQAEGGRIAHVKPHGALYNQAARDPQIA
DAIVSAVHDFDPSVAVFALANSGLVTAARNVGLVAIEEVFADRGYRADGSLVPRKEPGAL
LEDEDEVLARTLTMVREQRVQAVSGEWVPLNAQTICLHGDGPHALAFAQRIRNALEAAGI
AVHAANAARV