Protein Info for QEN71_RS27850 in Paraburkholderia sabiae LMG 24235

Annotation: MarC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 89 (27 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details PF01914: MarC" amino acids 3 to 201 (199 residues), 202.7 bits, see alignment E=2.2e-64 TIGR00427: membrane protein, MarC family" amino acids 3 to 198 (196 residues), 195.8 bits, see alignment E=3.4e-62

Best Hits

Swiss-Prot: 39% identical to Y267_BUCAI: UPF0056 membrane protein BU267 (BU267) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 98% identity to bph:Bphy_2756)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>QEN71_RS27850 MarC family protein (Paraburkholderia sabiae LMG 24235)
MDIIKSFISLLALINPVGAIPFFLSLTSQQSVAEQRRTIRIASISVFCVIAVTTLLGQQI
IRFFGISIGALEVGGGIIMLLMSISMLNAQVGNARSTPEERHEAEMKDNIAVVPLAIPLL
TGPGSISTVLVYSASYPHWYERISLIVIGAVIAALCFGSLSLAEPIARWVGRTGINIGTR
LMGLMLSALAVEFIVNGLKALLPNLK