Protein Info for QEN71_RS27850 in Paraburkholderia sabiae LMG 24235

Annotation: MarC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01914: MarC
  • amino acids 3 to 201 (199 residues), 202.7 bits, E=2.2e-64
• TIGR00427: membrane protein, MarC family
  • amino acids 3 to 198 (196 residues), 195.8 bits, E=3.4e-62

Best Hits

Swiss-Prot: 39% identical to Y267_BUCAI: UPF0056 membrane protein BU267 (BU267) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 98% identity to bph:Bphy_2756)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Protein Sequence (206 amino acids)

>QEN71_RS27850 MarC family protein (Paraburkholderia sabiae LMG 24235)
MDIIKSFISLLALINPVGAIPFFLSLTSQQSVAEQRRTIRIASISVFCVIAVTTLLGQQI
IRFFGISIGALEVGGGIIMLLMSISMLNAQVGNARSTPEERHEAEMKDNIAVVPLAIPLL
TGPGSISTVLVYSASYPHWYERISLIVIGAVIAALCFGSLSLAEPIARWVGRTGINIGTR
LMGLMLSALAVEFIVNGLKALLPNLK